If you have been reading about obesity research and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Last reviewed on 2026-08-01. Where a claim depends on a specific study, the study is described rather than over-claimed.
AOD-9604 drew attention in the 1990s and 2000s as a potential anti-obesity agent. Early work explored both injectable and oral routes, which is unusual for a peptide of this size. Animal studies reported changes in fat metabolism without the growth-promoting or insulin-like effects associated with full-length growth hormone. Subsequent human trials produced mixed or modest results, and the compound did not obtain regulatory approval for weight management in major markets. It remains known mainly through research literature, sports anti-doping listings, and non-approved supplement advertising.
AOD-9604 is prohibited in sport by the World Anti-Doping Agency under the peptide hormone class. Its presence in a sample can be detected through mass spectrometry-based methods, although the exact assay depends on the laboratory. In research settings, material is often supplied as a lyophilized powder for reconstitution. Buyers and researchers should note that products labeled AOD-9604 may vary in purity and actual peptide content. Analytical certificates and independent testing are common ways to verify identity, but no global harmonized standard exists for all commercial lots.
Commercial AOD-9604 may vary in purity, counterion content, and residual moisture. Certificates of analysis often report HPLC purity, mass confirmation, and appearance, but testing methods differ between suppliers. Independent verification is sometimes used because labeled content may not match actual peptide amount. Stability under different pH and temperature conditions is not fully standardized across studies. Researchers generally treat lyophilized material as the reference form for weighing and reconstitution. Moisture content can affect accurate mass measurement.
AOD-9604 is typically supplied as a lyophilized white to off-white powder. In this form, it is relatively stable when kept cool, dry, and protected from light. Common storage recommendations place it at −20 °C or below for long-term retention. Reconstituted solutions are less stable and are often kept at 2–8 °C for short periods. Freeze-thaw cycles should be minimized because they can promote aggregation or loss of peptide content. Vials are usually sealed under inert gas to reduce oxidation.
| Property | Value | Notes |
|---|---|---|
| Molecular class | Synthetic peptide | Fragment analog of human growth hormone |
| Sequence basis | hGH 176–191 region | Modified C-terminal fragment |
| Common synonyms | AOD-9604; AOD9604; hGH fragment | Research and trade names vary |
| Regulatory status | Not approved as a drug | Prohibited in competitive sport |
| Research code | AOD9604 | Used in scientific and patent literature |
Researchers have studied the fragment in cell and animal models to understand its metabolic actions. Some experiments report effects on fat breakdown and fat storage pathways, but the underlying mechanism remains incompletely defined. AOD-9604 does not appear to stimulate the same broad growth hormone receptor signaling as full-length hGH. Whether its observed activities arise from direct receptor interactions or downstream metabolic changes is an open question. Results from different assays are not always consistent.
AOD-9604 is a synthetic peptide modeled on the C-terminal region of human growth hormone. It corresponds to residues 176-191 of the 191-amino-acid hGH sequence. The fragment is not the full hormone and lacks the receptor-binding region associated with growth and metabolic effects of hGH. Researchers developed it to isolate a specific portion of hGH for study. Its exact sequence and length are often stated in peptide catalogs and patents.
Regulatory treatment of AOD-9604 has varied. In sports anti-doping, the peptide became widely discussed during a 2013 investigation into an Australian professional sports club. Authorities at the time debated whether it fell under prohibitions on growth hormone and related substances. Later clarifications and updated lists have addressed the compound in different ways. Anyone seeking current status should consult the latest applicable rules, and commercial supply for human use is not authorized in major markets.
Research interest in AOD-9604 often focuses on whether it can influence lipid metabolism without the growth-promoting or glucose-related effects of full-length hGH. This question remains unresolved, and findings depend on model, dose, and measurement method. Some reviews treat the peptide as a historical obesity candidate rather than an active therapeutic. Others cite it in discussions of peptide fragments, metabolic signaling, and performance-enhancing substances. Clear conclusions are limited by the small number of rigorous, independent human studies.
AOD-9604 has been investigated primarily as a potential treatment for obesity and related metabolic conditions. Early laboratory work examined its effects on fat cells, and later studies moved into animal models and human clinical trials. Some trials reportedly reached Phase II, but the program did not lead to an approved medicine. Published summaries often note that weight-loss results were modest or inconsistent. The full trial data are not all publicly available in detail.
AOD-9604 is a synthetic peptide modeled on the C-terminal region of human growth hormone. It is often described as hGH fragment 176-191. Research interest arose because it was designed to isolate possible effects on fat metabolism from other actions of growth hormone. It is not a full growth hormone molecule. Its development history includes early laboratory and animal studies followed by human trials. The peptide has been examined in laboratory, animal, and limited human studies.
The compound has been studied as a potential treatment for obesity and related metabolic conditions. Published trials have examined changes in body weight, fat mass, and safety markers over limited durations. Results have been mixed or modest, and no large-scale outcome trials are established. Regulatory agencies in several countries have not approved it as a therapeutic drug. Some commercial products have been marketed outside regulated pharmaceutical channels, which raises questions about quality and claims.
=== Bibliography === Woodward, A.S. (1900): On some remains of Grypotherium (Neomylodon) listai and associated mammals from a cavern near Consuelo Cove, Last Hope Inlet. Proceedings of the Zoological Society of London, 1900(5): 64–79.
==== Illegal marketing of gabapentin for off-label uses settlement (2004) ==== In 1993, the Food and Drug Administration (FDA) approved gabapentin only for treatment of seizures. Warner–Lambert, which merged with Pfizer in 2000, used continuing medical education and medical research, sponsored articles about the drug for the medical literature, and alleged suppression of unfavorable study results, to promote gabapentin. Within five years, the drug was being widely used for off-label uses such as treatment of pain and psychiatric conditions. Warner–Lambert admitted to violating FDA regulations by promoting the drug for pain, psychiatric conditions, migraine, and other unapproved uses. In 2004, the company paid $430 million in one of the largest settlements to resolve criminal and civil health care liability charges. It was the first off-label promotion case successfully brought under the False Claims Act. A Cochrane review concluded that gabapentin is ineffective in migraine prophylaxis. The American Academy of Neurology rates it as having unproven efficacy, while the Canadian Headache Society and the European Federation of Neurological Societies rate its use as being supported by moderate and low-quality evidence.
Kiggans announced on April 12, 2021, that she was running for Virginia's 2nd congressional district to challenge Democratic incumbent Elaine Luria in the 2022 election. Virginia's 2nd district—redrawn after the 2020 census—contains Chesapeake, the Eastern Shore, Isle of Wight, Southampton County, Suffolk County, and Virginia Beach. Kiggans secured her party's nomination on June 21, 2022, after defeating Jarome Bell in the Republican primary with 56% of the vote. She campaigned on issues regarding the economy and inflation, as well as transgenderism and the parental rights movement. The Cook Political Report rated the election as a "tossup" by November 7, 2022. Kiggans defeated Luria in the November general election—a race viewed as critical for the Republican Party to regain its House majority in the 2022 midterms.
; nevertheless, the concentrations on either side of the membrane need not be equal. Spontaneous movement across the potential membrane is determined by both concentration and electric potential gradients. The molar Gibbs free energy
== Function == Peritenon provides vascular supply for Achilles tendon along with vessels from musculotendinous junction proximally, the periosteum distally. There is a relatively avascular zone located 2–6 cm proximal to its insertion that is named "watershed area of the tendo Achilles". The watershed area's blood supply is mainly from the peritenon, specifically vessels in the mesotenon anteriorly.
Sources: en.wikipedia.org
=== Beyond Raw === GNC is a company that offers creatine supplements in both pill and powder forms through its GNC AMP® and Beyond Raw® Chemistry Labs product lines. Their products have been scientifically supported and clinically tested, such as the GNC AMP® Creatine HCl 189™. In collaboration with The Hershey Company, products like Beyond Raw® LIT™ JOLLY RANCHER Grape pre-workout powder and on the-go have been produced which come in flavours like watermelon, green apple, and blue raspberry. Each pre-workout supplement contains clinically dosed ingredients, such as L-Citrulline, CarnoSyn betaalanine, micronized creatine, caffeine, and Nitrosigine. Other supplements like Burn MF Metabolic Activator Powder, Capsules, Sticks, and Drink belong to the Beyond Raw brand. Additionally, the text mentions that a new flavor, JOLLY RANCHER Grape, has been launched after the release of another supplement called Beyond Raw Concept X in May 2022. However, in a settlement with the Department of Justice, GNC, the largest retailer of supplements in the country, has agreed to pay $2.25 million. This settlement comes as part of a larger effort by the federal government to crack down on supplements that contain undisclosed drug ingredients, harmful compounds, or inaccurate ingredient labeling. As part of the settlement, GNC has committed to improving its product screening process and removing any supplements containing illegal or unsafe ingredients. In addition, the company will maintain a list of products that have been deemed safe for sale.
PET scans are increasingly read alongside CT or MRI scans, with the combination (co-registration) giving both anatomic and metabolic information (i.e., what the structure is, and what it is doing biochemically). Because PET imaging is most useful in combination with anatomical imaging, such as CT, modern PET scanners are now available with integrated high-end multi-detector-row CT scanners (PET–CT). Because the two scans can be performed in immediate sequence during the same session, with the patient not changing position between the two types of scans, the two sets of images are more precisely registered, so that areas of abnormality on the PET imaging can be more perfectly correlated with anatomy on the CT images. This is very useful in showing detailed views of moving organs or structures with higher anatomical variation, which is more common outside the brain. At the Jülich Institute of Neurosciences and Biophysics, the world's largest PET–MRI device began operation in April 2009. A 9.4-tesla magnetic resonance tomograph (MRT) combined with a PET. Presently, only the head and brain can be imaged at these high magnetic field strengths. For brain imaging, registration of CT, MRI and PET scans may be accomplished without the need for an integrated PET–CT or PET–MRI scanner by using a device known as the N-localizer.
Xanthoria parietina grows at an average rate of about 2.6 mm per year, though growth varies with habitat. Moist sub-montane environments support faster growth (6–7 mm/year), while drier coastal regions slow expansion. Growth peaks in cold, wet seasons (autumn/winter) and declines in warm, dry conditions, such as Mediterranean climates. The slow growth of X. parietina influences its longevity and dispersal. Without active water uptake, high evaporative demand limits metabolism, especially in wind-exposed, low-altitude regions, where desiccation slows thallus expansion and reduces propagule success. In contrast, high humidity supports steady radial growth, allowing long-term persistence, biomass accumulation, and continuous ascospore release. Strong winds both hinder and aid X. parietina. While wind exposure dehydrates thalli and slows growth, it also disperses thallus fragments, which serve as vegetative propagules in the absence of specialized structures, supplementing spore-based dispersal. Xanthoria parietina releases and germinates spores year-round, though germination is faster in summer (4–5 days) and slower in winter. Optimal germination occurs at pH 6, but spores tolerate pH 3–7. Germination success and mycobiont development are influenced by multiple environmental factors. Substrate affects success—germination is higher on agar than in water films. In the laboratory, the ascospores of X. parietina germinate best in liquid nutrient media, particularly malt-yeast extract, which provides essential carbohydrates, amino acids, and vitamins.
the act was of such a lewd character as to outrage public decency; this element constitutes the nature of the act, which has to be proved before the offence can be established, and the act took place in a public place and must have been capable of being seen by two or more persons who were actually present, even if they did not actually see it. The mens rea of this offence can be satisfied if the defendant intentionally does an act which outrages public decency, regardless of one's state of mind. Judge Peter Rook QC and Robert Ward suggest that obiter dicta in cases such as R v Thallman (1863) 9 Cox CC 388 indicate that the requirement of a "public place" may be falling out of favour, due to its vagueness and redundancy to the requirement for two potential witnesses. In R v Hamilton [2007] EWCA Crim 2062 an act of upskirting in public went undetected until a police search discovered indecent images. It was held that it was immaterial whether a person had actually seen the act, provided it was capable of being seen by at least two persons. Previous cases had all been seen, but this was held to be a matter of evidence, not an element of the offence.
Another common example is the reaction of a primary amine or secondary amine with a carboxylic acid or with a carboxylic acid derivative to form an amide. This reaction is widely used, especially in the synthesis of peptides. On the simple addition of an amine to a carboxylic acid, a salt of the organic acid and base is obtained. To overcome this, the carboxylic acid first needs to be "activated". This is usually done by converting the acid into a more reactive derivative (i.e. anhydride, acid halide) or by using a coupling agent. In some cases, high temperatures (>200 °C) can overcome salt formation by driving off water, without the need for "activation" of the carboxyl group. The downside to this simple reaction is that the compounds may decompose at these elevated temperatures. The carboxylic acid derivatives can be esters, anhydrides, acid halides or any other activated species. The choice of activated carboxyl group or coupling agent can be very important in peptide synthesis, as using the wrong one can lead to racemization.
Sources: en.wikipedia.org
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
Additionally, less stable fission products are less likely to decay to stable nuclides, instead decaying to other radionuclides, which undergo further decay and radiation emission, adding to the radiation output. It is these short lived fission products that are the immediate hazard of spent fuel, and the energy output of the radiation also generates significant heat which must be considered when storing spent fuel. As there are hundreds of different radionuclides created, the initial radioactivity level fades quickly as short lived radionuclides decay, but never ceases completely as longer lived radionuclides make up more and more of the remaining unstable atoms. In fact the short lived products are so predominant that 87 percent decay to stable isotopes within the first month after removal from the reactor core.
== History == Insulin degludec has been filed for registration in the United States. After the completion of additional cardiac safety studies requested by the US Food and Drug Administration (FDA) in February 2013, it received FDA approval in September 2015 and marketing began in January 2016.
==== Effects on plasticity ==== Activation of group 1 mGluRs are implicated in synaptic plasticity and contribute to both neurotoxicity and neuroprotection such as protection of the retina against NMDA toxicity, mentioned above. It causes a reduction in ZENK expression, which leads to myopia in chicken.
Sources: en.wikipedia.org
No. It is a synthetic peptide fragment modeled on part of human growth hormone, not the full hormone. It does not contain the complete sequence or receptor-binding regions of hGH.
It was investigated in clinical trials for obesity, but it did not receive approval for that use in major markets. Results were generally modest or mixed, and it remains an experimental compound.
WADA lists it as a prohibited peptide hormone. Its use can be detected by laboratory methods, and athletes are subject to sanctions if it is found in samples.
Lyophilized powder is commonly stored at −20 °C or below, protected from light and moisture. Reconstituted solutions are typically kept refrigerated and used within a limited period.