en · de · pt
aod-9604-notes.peptides4800.com › Info › Identity And Research Background — Questions and Answers

Identity And Research Background — Questions and Answers

By Editorial Desk · published 2026-01-09 · last reviewed 2026-02-18 · Info

If you have been reading about anti-doping and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.

Last reviewed on 2026-02-18. Where a claim depends on a specific study, the study is described rather than over-claimed.

Identity And Research Background

AOD-9604 drew attention in the 1990s and 2000s as a potential anti-obesity agent. Early work explored both injectable and oral routes, which is unusual for a peptide of this size. Animal studies reported changes in fat metabolism without the growth-promoting or insulin-like effects associated with full-length growth hormone. Subsequent human trials produced mixed or modest results, and the compound did not obtain regulatory approval for weight management in major markets. It remains known mainly through research literature, sports anti-doping listings, and non-approved supplement advertising.

AOD-9604 is prohibited in sport by the World Anti-Doping Agency under the peptide hormone class. Its presence in a sample can be detected through mass spectrometry-based methods, although the exact assay depends on the laboratory. In research settings, material is often supplied as a lyophilized powder for reconstitution. Buyers and researchers should note that products labeled AOD-9604 may vary in purity and actual peptide content. Analytical certificates and independent testing are common ways to verify identity, but no global harmonized standard exists for all commercial lots.

Background And Research Context

In the scientific literature, AOD-9604 appears in reviews of growth hormone fragments and in discussions of peptide-based metabolic research. Some sources distinguish it from growth hormone itself, while others group it with compounds marketed for weight management. The evidence base is small compared with approved obesity medications. Questions about long-term efficacy and clinical relevance remain open, and independent replication of key findings is limited. Most published reports are early-stage and exploratory.

AOD-9604 is a synthetic peptide modeled on the C-terminal region of human growth hormone. It is often described as hGH fragment 176-191. Research interest arose because it was designed to isolate possible effects on fat metabolism from other actions of growth hormone. It is not a full growth hormone molecule. Its development history includes early laboratory and animal studies followed by human trials. The peptide has been examined in laboratory, animal, and limited human studies.

The compound has been studied as a potential treatment for obesity and related metabolic conditions. Published trials have examined changes in body weight, fat mass, and safety markers over limited durations. Results have been mixed or modest, and no large-scale outcome trials are established. Regulatory agencies in several countries have not approved it as a therapeutic drug. Some commercial products have been marketed outside regulated pharmaceutical channels, which raises questions about quality and claims.

Aod-9604 at a glance

PropertyValueNotes
Molecular classSynthetic peptideFragment analog of human growth hormone
Sequence basishGH 176–191 regionModified C-terminal fragment
Common synonymsAOD-9604; AOD9604; hGH fragmentResearch and trade names vary
Regulatory statusNot approved as a drugProhibited in competitive sport
Research codeAOD9604Used in scientific and patent literature

Identity and Research Origin

Regulatory status varies by country. In the United States, AOD-9604 is not approved as a prescription drug. It is sometimes sold as a research chemical or dietary supplement, though such marketing may fall outside legal frameworks. The World Anti-Doping Agency prohibits its use in sport. Researchers must obtain it through legitimate suppliers and follow institutional rules. Its legal classification continues to evolve as authorities increasingly assess peptide products more broadly.

AOD-9604 is a synthetic peptide whose sequence matches the C-terminal fragment of human growth hormone, specifically residues 176 through 191. This region differs from the full hormone in its receptor interactions. The peptide is not a growth hormone secretagogue and does not bind the growth hormone receptor in the same manner. Researchers have examined it for effects on lipid metabolism, but its exact pharmacological profile remains an active area of study.

Related pages on this site

Research and Regulatory Context

Regulatory bodies have taken different approaches to AOD-9604. It is not approved as a prescription medicine by major agencies such as the U.S. Food and Drug Administration or the European Medicines Agency. In sport, the World Anti-Doping Agency prohibits peptide hormones, growth factors, and related substances, and AOD-9604 has been treated as a prohibited substance. These regulatory decisions reflect concerns about safety, efficacy, and potential misuse rather than proof of benefit.

Research on AOD-9604 also examines how the peptide is measured in biological samples. Analytical methods may include liquid chromatography coupled with mass spectrometry, immunoassays, or both. Detection can be challenging because the peptide is small and may be present at low concentrations. Published methods vary in sensitivity and specificity, so comparative interpretation requires attention to validation details. The presence of related hGH fragments can complicate identification in some matrices.

AOD-9604 has been investigated mainly in the context of body fat and metabolic endpoints. Some early animal and small human studies reported changes in fat mass or lipid markers, but findings were not uniform. Larger, well-controlled trials that would establish efficacy are lacking in the public literature. As a result, claims about weight loss or metabolic benefit remain investigational rather than established. The distinction between a research finding and a proven clinical outcome is central to discussing this peptide.

Supporting material

Solid-liquid extraction based ambient ionization is based on the use of a charged spray, for example electrospray to create a liquid film on the sample surface. Molecules on the surface are extracted into the solvent. The action of the primary droplets hitting the surface produces secondary droplets that are the source of ions for the mass spectrometer. Desorption electrospray ionization (DESI) is one of the original ambient ionization sources and uses an electrospray source to create charged droplets that are directed at a solid sample. The charged droplets pick up the sample through interaction with the surface and then form highly charged ions that can be sampled into a mass spectrometer. Desorption atmospheric pressure photoionization (DAPPI) is a solid-liquid extraction ambient ionization method that enables the direct analysis of samples deposited on surfaces by means of a jet of hot solvent vapour and ultraviolet light. The hot jet thermally desorbs the sample from a surface and the vaporized sample is ionized by a vacuum ultraviolet light and consequently sampled into a mass spectrometer.

These cyclic dipeptides incorporate both donor and acceptor groups for hydrogen bonding. They are conformationally constrained nearly planar scaffolds. Diversity can be introduced at up to six positions and stereochemistry controlled at up to four positions. They are stable to proteolysis. These characteristics underpin theis biologically activity and utility in medicinal chemistry. As a consequence of their predominant biosynthetic origin from L-α-amino acids most naturally occurring 2,5-DKPs are cis configured as the cyclo(L-Xaa-L-Yaa) isomers. 2,5-DKPs epimerize under basic, acidic and thermal conditions. The composition of the cis and trans isomers in the equilibrium state varies widely depending on the bulk of the side chains, if a ring (e.g. proline) is present, or if the nitrogen atoms are alkylated . Although epimerization was historically an issue in the synthesis of 2,5-DKPs, several mild methods have been developed recently that avoid epimerization.

The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.

The second modification allows a substantial simplification of the classic theory, and so application in complex metabolic networks. The theory on synthesizing units is used in dynamic energy budget theory, where 4 basic modes are distinguished: the substrates can be substitutable or supplementary (= complementary); if the transformations A -> C and B -> C can occur, substrates A and B are said to be substitutable with respect to their transformation to C, if both are required to produce C they are said to be supplementary the processing of these substrates by SUs can be sequential or parallel; if in the transformation A + B -> C the binding of substrate A to the SU does not affect that of B, these substrates are processed simultaneously, if not these substrates are processed sequentially Mixtures of the 4 basic modes can occur, especially if the substrates represent generalized compounds, rather than pure chemical compounds. A generalized compound is a mixture of chemical compounds that does not change in composition.

Treatments aiming to inhibit works to block specific caspases. Finally, the Akt protein kinase promotes cell survival through two pathways. Akt phosphorylates and inhibits Bad (a Bcl-2 family member), causing Bad to interact with the 14-3-3 scaffold, resulting in Bcl dissociation and thus cell survival. Akt also activates IKKα, which leads to NF-κB activation and cell survival. Active NF-κB induces the expression of anti-apoptotic genes such as Bcl-2, resulting in inhibition of apoptosis. NF-κB has been found to play both an antiapoptotic role and a proapoptotic role depending on the stimuli utilized and the cell type. The progression of the human immunodeficiency virus infection into AIDS is due primarily to the depletion of CD4+ T-helper lymphocytes in a manner that is too rapid for the body's bone marrow to replenish the cells, leading to a compromised immune system. One of the mechanisms by which T-helper cells are depleted is apoptosis, which results from a series of biochemical pathways:

Sources: en.wikipedia.org

Notes from published material

Network Science, Part 5: Solvent-Accessible Surfaces AREAIMOL is a command line tool in the CCP4 Program Suite for calculating ASA. NACCESS solvent accessible area calculations. FreeSASA Open source command line tool, C library and Python module for calculating ASA. Surface Racer Oleg Tsodikov's Surface Racer program. Solvent accessible and molecular surface area and average curvature calculation. Free for academic use. ASA.py — a Python-based implementation of the Shrake-Rupley algorithm. Michel Sanner's Molecular Surface – the fastest program to calculate the excluded surface. pov4grasp render molecular surfaces. Molecular Surface Package — Michael Connolly's program. Volume Voxelator — A web-based tool to generate excluded surfaces. ASV freeware Analytical calculation of the volume and surface of the union of n spheres (Monte-Carlo calculation also provided). Vorlume Computing Surface Area and Volume of a Family of 3D Balls. GetArea Calculate solvent accessible surface area of proteins online. ProMS ProMS - Protein Molecular Surface Calculator

The difference between enzymatically active and inactive homologues has been noted (and in some cases, understood when comparing catalytically active and inactive proteins residing in recognisable families) for some time at the sequence level, owing to the absence of key catalytic residues. Some pseudoenzymes have also been referred to as 'prozymes' when they were analysed in protozoan parasites. The best studied pseudoenzymes reside amongst various key signalling superfamilies of enzymes, such as the proteases, the protein kinases, protein phosphatases and ubiquitin modifying enzymes. The role of pseudoenzymes as "pseudo scaffolds" has also been recognised and pseudoenzymes are now beginning to be more thoroughly studied in terms of their biology and function, in large part because they are also interesting potential targets (or anti-targets) for drug design in the context of intracellular cellular signalling complexes. Kinase Pseudokinase Phosphatome Protein phosphatase "Patrick Eyers - University of Liverpool". Liverpool.ac.uk. Retrieved 2017-01-16.

Transferred components are immune cells and autologous as above. Transfer of immune cells is made between different individuals of monozygotic twins in human or of the same pure line in experimental animals from immunologically sensitized to naive host, where transferred cells are engrafted without rejection or GVHD in the new host. Transfer of cells are made between allogeneic hosts but the new host is irradiated for preventing rejection or GVHD. Transfer of cells are made between allogeneic hosts. Transferred components include cells as well as immune molecules such as immunoglobulins between allogeneic hosts. The term is used almost synonymously for "passive immunity" in some situations, however, passive immunity acts among xenogeneic hosts; for example, in snake venom immunotherapy, antivenom IgG is obtained from sensitized horse and inoculated to humans. The following terms might indicate procedures involving similar immunological transfer processes. adoptive transfer adoptive immunization adoptive immunotherapy Adoptive cell therapy adoptive tolerance

Tripartite motif-containing 24 (TRIM24) also known as transcriptional intermediary factor 1α (TIF1α) is a protein that, in humans, is encoded by the TRIM24 gene. The protein encoded by this gene mediates transcriptional control by interaction with the activation function 2 (AF2) region of several nuclear receptors, including the estrogen, retinoic acid, and vitamin D3 receptors. The protein localizes to nuclear bodies and is thought to associate with chromatin and heterochromatin-associated factors. The protein is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains – a RING, a B-box type 1 and a B-box type 2 – and a coiled-coil region. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. TRIM24 has been shown to interact with Mineralocorticoid receptor, TRIM33, Estrogen receptor alpha and Retinoid X receptor alpha. Transcription coregulator

The Australian Radiation Protection and Nuclear Safety Agency (ARPANSA) is a regulatory agency under the Commonwealth of Australia that aims to protect Australian citizens from both ionising and non-ionising radiation. ARPANSA works under the guidance of the Australian Radiation Protection and Nuclear Safety Act of 1998 as the national regulatory body of radiation in Australia, with independent departments within each state and territory that regulate radiation within each of their jurisdictions. The Australian Radiation Protection and Nuclear Safety (ARPANS) Bill 1998 was passed by the Australian House of Representatives in May 1998, however Parliament was prorogued for the Federal Election (held 3 October 1998) before the Bill could be considered by the Senate. The Bill was reintroduced into Parliament in November 1998 and passed by both Houses of Parliament on Thursday 10 December 1998. ARPANSA's responsibilities include:

Sources: en.wikipedia.org

Further detail

Once the substrate is bound and oriented to the active site, catalysis can begin. The residues of the catalytic site are typically very close to the binding site, and some residues can have dual-roles in both binding and catalysis. Catalytic residues of the site interact with the substrate to lower the activation energy of a reaction and thereby make it proceed faster. They do this by a number of different mechanisms including the approximation of the reactants, nucleophilic/electrophilic catalysis and acid/base catalysis. These mechanisms will be explained below.

Arterial damage results from white blood cell invasion and inflammation within the wall. CRP is a general marker for inflammation and infection, so it can be used as a very rough proxy for heart disease risk. Since many things can cause elevated CRP, this is not a very specific prognostic indicator. Nevertheless, a level above 2.4 mg/L has been associated with a doubled risk of a coronary event compared to levels below 1 mg/L; however, the study group in this case consisted of patients who had been diagnosed with unstable angina pectoris; whether elevated CRP has any predictive value of acute coronary events in the general population of all age ranges remains unclear. Currently, C-reactive protein is not recommended as a cardiovascular disease screening test for average-risk adults without symptoms. The American Heart Association and U.S. Centers for Disease Control and Prevention have defined risk groups as follows:

MAAs are widespread in the microbial world and have been reported in many microorganisms including heterotrophic bacteria, cyanobacteria, microalgae, ascomycetous and basidiomycetous fungi, as well as some multicellular organisms such as macroalgae and marine animals. Most research done on MAAs is on their light absorbing and radiation protecting properties. The first thorough description of MAAs was done in cyanobacteria living in a high UV radiation environment. The major unifying characteristic among all MAAs is UV light absorption. All MAAs absorb UV light that can be destructive to biological molecules (DNA, proteins, etc.). Though most MAA research is done on their photo-protective capabilities, they are also considered to be multi-functional secondary metabolites that have many cellular functions. MAAs are effective antioxidant molecules and are able to stabilize free radicals within their ring structure. In addition to protecting cells from mutation via UV radiation and free radicals, MAAs are able to boost cellular tolerance to desiccation, salt stress, and heat stress.

Biopolymers are polymers produced by living organisms. Cellulose and starch, proteins and peptides, and DNA and RNA are all examples of biopolymers, in which the monomeric units, respectively, are sugars, amino acids, and nucleotides. Cellulose is both the most common biopolymer and the most common organic compound on Earth. About 33% of all plant matter is cellulose. On a similar manner, silk (a proteinaceous biopolymer) has garnered tremendous research interest across various domains, including tissue engineering, regenerative medicine, microfluidics, and drug delivery. Bionics Hydrogel Polymeric surface Surface modification of biomaterials with proteins Synthetic biodegradable polymer List of biomaterials Oxygen generating biomaterial Journal of Biomaterials Applications CREB – Biomedical Engineering Research Centre Archived 2021-05-07 at the Wayback Machine Department of Biomaterials at the Max Planck Institute of Colloids and Interfaces in Potsdam-Golm, Germany Open Innovation Campus for Biomaterials Archived 2009-04-19 at the Wayback Machine

Sources: en.wikipedia.org

Frequently asked questions

Is AOD-9604 the same as human growth hormone?

No. It is a synthetic peptide fragment modeled on part of human growth hormone, not the full hormone. It does not contain the complete sequence or receptor-binding regions of hGH.

Was AOD-9604 approved for weight loss?

It was investigated in clinical trials for obesity, but it did not receive approval for that use in major markets. Results were generally modest or mixed, and it remains an experimental compound.

Why is AOD-9604 banned in sports?

WADA lists it as a prohibited peptide hormone. Its use can be detected by laboratory methods, and athletes are subject to sanctions if it is found in samples.

What is AOD-9604?

It is a synthetic peptide fragment derived from the C-terminal region of human growth hormone, commonly referred to as hGH fragment 176-191. It has been investigated for effects on fat metabolism, but it is not an approved medication in most jurisdictions.

Network